Rosetta@Home version 3.30

Message boards : Number crunching : Rosetta@Home version 3.30

To post messages, you must log in.

Previous · 1 · 2

AuthorMessage
Profile [VENETO] boboviz

Send message
Joined: 1 Dec 05
Posts: 2092
Credit: 12,296,602
RAC: 13,692
Message 73016 - Posted: 7 May 2012, 14:46:06 UTC

Some errors with wus secY_hybrid_02

504195042
504195047

- Unhandled Exception Record -
Reason: Out Of Memory (C++ Exception) (0xe06d7363) at address 0x7C812AFB

Engaging BOINC Windows Runtime Debugger...
ID: 73016 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Tex1954

Send message
Joined: 3 Apr 11
Posts: 9
Credit: 3,394,752
RAC: 0
Message 73024 - Posted: 8 May 2012, 22:52:54 UTC

I'm seeing about 1 in 50 errors as well. These seemed to error out on the wingmans machine as well. Clearly there is some glitch in the 3.30 workunits...

However, about 6 of them were because of me when I tried to increase RAM with mixed G-Skill/Corsair parts and it buggered up long term... Oh well.. I knew I was taking a chance... order more Corsair to do it properly.

Many error out now (with ram restored correctly) in the first few minutes or seconds and the wingmans do as well. Soooo, don't think it is really a problem on my system..

Also, FWIW, all my running boxes have GPU's do tasks as well.

It's too bad the WU display here doesn't show the normal Error, Pending, Valid selections that most BOINC websites have or it would be a lot easier to figure things out.

Still crunching! Seem to be getting fewer errors as I work through the last batch that downloaded..

8-)
ID: 73024 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Michael G.R.

Send message
Joined: 11 Nov 05
Posts: 264
Credit: 11,247,510
RAC: 0
Message 73058 - Posted: 13 May 2012, 4:10:55 UTC

Got some system-wide slowdowns, high RAM usage, and a couple computation errors with 3.30.
ID: 73058 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
P . P . L .

Send message
Joined: 20 Aug 06
Posts: 581
Credit: 4,865,274
RAC: 0
Message 73061 - Posted: 14 May 2012, 5:40:40 UTC

Hi.

Had this one error today, after 18sec.

https://boinc.bakerlab.org/rosetta/workunit.php?wuid=460839382

ab_11_29__optpps_T5311_optpps_03_09_35686_277399_1

<core_client_version>6.10.58</core_client_version>
<![CDATA[
<message>
process exited with code 1 (0x1, -255)
</message>
<stderr_txt>


Initialization complete.
Setting WU description ...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME
can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3

ERROR: core::util::switch_to_residue_type_set fails

ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

</stderr_txt>
]]>

ID: 73061 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Menace

Send message
Joined: 4 Nov 05
Posts: 2
Credit: 167,345
RAC: 0
Message 73067 - Posted: 15 May 2012, 15:39:30 UTC

Not had any errors, but as these units work through, they fail to upload, so I have 22 units complete but going nowhere. Some seem partially uploaded. A retry sees them upload, but only to the percentage that they had stopped at before, then zilch. This just started to happen by itself, so I'm guessing that all the successfully completed and uploaded WUs were pre-3.30.
Any news would be good!
Dennis
ID: 73067 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Mod.Sense
Volunteer moderator

Send message
Joined: 22 Aug 06
Posts: 4018
Credit: 0
RAC: 0
Message 73068 - Posted: 16 May 2012, 2:32:57 UTC

Menace, how many K of the file is getting sent up before it ends? It shouldn't reset to zero if anything is actually reaching the upload server. Uploads should not be dependent upon a specific R@h version either. I am just a home user like everyone else, and I've not been seeing any upload problems. Perhaps you have a firewall or other network issue somewhere?

Are others having upload problems?
Rosetta Moderator: Mod.Sense
ID: 73068 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
P . P . L .

Send message
Joined: 20 Aug 06
Posts: 581
Credit: 4,865,274
RAC: 0
Message 73070 - Posted: 16 May 2012, 6:59:38 UTC
Last modified: 16 May 2012, 7:00:02 UTC

Hi.

This is an odd one it ran for 1hr, 30min then erred.

Rc015_broker_pairings_50135_4819_0

https://boinc.bakerlab.org/rosetta/workunit.php?wuid=461221621

( last part of log )

Unpacking WU data ...
Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/Rc015_pairings_broker_input.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
BOINC:: Worker startup.
Starting watchdog...
Watchdog active.
# cpu_run_time_pref: 14400

ERROR: impossible to find a valid fold-tree with given sheet-topology and pairings
ERROR:: Exit from: src/protocols/jumping/SheetBuilder.cc line: 328
called boinc_finish

</stderr_txt>
]]>
ID: 73070 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
P . P . L .

Send message
Joined: 20 Aug 06
Posts: 581
Credit: 4,865,274
RAC: 0
Message 73078 - Posted: 17 May 2012, 0:58:01 UTC

Hi.

Is it better to abort tasks i have for mini 3.30, so you get BETTER usable results with the new app.

[Quote] May 16, 2012
Rosetta@Home software updated to version 3.31. Addresses issues with improper initialization of inputs in hybrid protocol for comparative modeling. /[quote]

I'm just asking after seeing this, specially with CASP running.

ID: 73078 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Previous · 1 · 2

Message boards : Number crunching : Rosetta@Home version 3.30



©2025 University of Washington
https://www.bakerlab.org